PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS62348.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family Dof
Protein Properties Length: 194aa    MW: 19781.8 Da    PI: 8.065
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS62348.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.19.4e-39564362
      zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                 ++l+cprCdstntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rkn k+s
  EPS62348.1  5 PEHLPCPRCDSTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGSRKNAKRS 64
                57899***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.7E-33762IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.264862IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101046IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-231262IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
PPPEPEHLPC PRCDSTNTKF CYYNNYNFSQ PRHFCKSCRR YWTHGGTLRD IPVGGGSRKN  60
AKRSRTGPAA MGSAATGVSG FAAAAAAAHH GFSASGDHGG GAPCFGDFLN AQGWGLGGFG  120
FGFGQRFGLE DVGFGIGRSL WPISGFVESG SGSMGGSSAG GYAWQSESGG GGFPGGGDCF  180
VLPELAISTP GGSL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00593DAPTransfer from AT5G66940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099306.15e-76PREDICTED: dof zinc finger protein DOF3.4
TrEMBLS8DI111e-137S8DI11_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0007s11790.19e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45322241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.11e-33OBF binding protein 1
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]